Dictionary.com
definitions
  • synonyms

inconsequent

[in-kon-si-kwent, -kwuh nt]
See more synonyms for inconsequent on Thesaurus.com
adjective
  1. characterized by lack of proper sequence in thought, speech, or action.
  2. characterized by lack of logical sequence; illogical; inconsecutive: inconsequent reasoning.
  3. irrelevant: an inconsequent remark.
  4. not following from the premises: an inconsequent deduction.
  5. not in keeping with the general character or design; inconsistent: inconsequent ornamentation.
  6. without worth or consequence; trivial: a frivolous, inconsequent young man.
Show More

Origin of inconsequent

1570–80; < Late Latin inconsequent- (stem of inconsequēns) not following. See in-3, consequent
Related formsin·con·se·quence, in·con·se·quent·ness, nounin·con·se·quent·ly, adverb
Dictionary.com Unabridged Based on the Random House Unabridged Dictionary, © Random House, Inc. 2018

Related Words

casualinconsequentialinconsiderableinsignificantlightminorminutenegligiblepaltrypettysmalltriflingtrivialunimportantshoestring

Examples from the Web for inconsequent

Historical Examples

  • Inconsequent, wholly illogical, utterly indefensible explosions.

    The Underdog

    F. Hopkinson Smith

  • Impetuous as he was inconsequent, M. de Kercadiou was bristling again.

    Scaramouche

    Rafael Sabatini

  • Why should they do everything so inconsequent, so improbable, so preposterous?

    The Tragic Muse

    Henry James

  • His remark was so inconsequent that Lucy found nothing to say.

    The Explorer

    W. Somerset Maugham

  • They were of both sexes, and upon the whole they were a silly, inconsequent set.

    The Message

    Alec John Dawson


Word Origin and History for inconsequent

adj.

1570s, "not following as a logical conclusion," from Latin inconsequentem (nominative inconsequens) "not logically connected," from in- "not, opposite of, without" (see in- (1)) + consequens, past participle of consequi "to follow" (see consequence).

Show More
Online Etymology Dictionary, © 2010 Douglas Harper