inconsequent
[in-kon-si-kwent, -kwuh nt]
- characterized by lack of proper sequence in thought, speech, or action.
- characterized by lack of logical sequence; illogical; inconsecutive: inconsequent reasoning.
- irrelevant: an inconsequent remark.
- not following from the premises: an inconsequent deduction.
- not in keeping with the general character or design; inconsistent: inconsequent ornamentation.
- without worth or consequence; trivial: a frivolous, inconsequent young man.
Show More
Origin of inconsequent
Dictionary.com Unabridged
Based on the Random House Unabridged Dictionary, © Random House, Inc. 2018
Related Words
casualinconsequentialinconsiderableinsignificantlightminorminutenegligiblepaltrypettysmalltriflingtrivialunimportantshoestringExamples from the Web for inconsequent
Historical Examples
Inconsequent, wholly illogical, utterly indefensible explosions.
The UnderdogF. Hopkinson Smith
Impetuous as he was inconsequent, M. de Kercadiou was bristling again.
ScaramoucheRafael Sabatini
Why should they do everything so inconsequent, so improbable, so preposterous?
The Tragic MuseHenry James
His remark was so inconsequent that Lucy found nothing to say.
The ExplorerW. Somerset Maugham
They were of both sexes, and upon the whole they were a silly, inconsequent set.
The MessageAlec John Dawson
Word Origin and History for inconsequent
adj.
1570s, "not following as a logical conclusion," from Latin inconsequentem (nominative inconsequens) "not logically connected," from in- "not, opposite of, without" (see in- (1)) + consequens, past participle of consequi "to follow" (see consequence).
Show More
Online Etymology Dictionary, © 2010 Douglas Harper