evaluate
[ih-val-yoo-eyt]
- to determine or set the value or amount of; appraise: to evaluate property.
- to judge or determine the significance, worth, or quality of; assess: to evaluate the results of an experiment.
- Mathematics. to determine or calculate the numerical value of (a formula, function, relation, etc.).
Show More
Origin of evaluate
First recorded in 1835–45; back formation from evaluation
Synonyms
See more synonyms for on Thesaurus.comDictionary.com Unabridged
Based on the Random House Unabridged Dictionary, © Random House, Inc. 2018
Related Words
calculategradeassessgaugedecideweighcheckclassifyappraisecriticizeassayreckonvaluaterankreadratesurveyvalueestimatepegExamples from the Web for evaluate
Contemporary Examples
In schools, this meant finding new ways to evaluate students—and hence their teachers.
Because these ingredients are so new, we need new methodologies just to evaluate them.
The Science of Ingredient InnovationDecember 15, 2014
Now we can set up a scientifically well prepared study to evaluate the transfusions vs. improved care.
DOJ and CDC numbers differ, and conviction rates are harder to evaluate.
When asked to evaluate his own work, Leigh was a little more reticent.
Historical Examples
I'll just give you my line of reasoning, and you can evaluate it for yourself.
Vampires of SpaceSewell Peaslee Wright
The historian is in a better position to evaluate the treaty.
Union and DemocracyAllen Johnson
The result is illustrative of the relation between what we do and how we evaluate what we do.
The Civilization of IlliteracyMihai Nadin
We cannot evaluate progress as an increase in a sum-total of happiness.
Progress and HistoryVarious
Our experts will evaluate such holdings and recompense the owners.
Medal of HonorDallas McCord Reynolds
evaluate
- to ascertain or set the amount or value of
- to judge or assess the worth of; appraise
- maths logic to determine the unique member of the range of a function corresponding to a given member of its domain
Show More
Word Origin
C19: back formation from evaluation, from French, from evaluer to evaluate; see value
Collins English Dictionary - Complete & Unabridged 2012 Digital Edition
© William Collins Sons & Co. Ltd. 1979, 1986 © HarperCollins
Publishers 1998, 2000, 2003, 2005, 2006, 2007, 2009, 2012
Word Origin and History for evaluate
v.
1842, from French évaluer or else a back-formation from evaluation. Originally in mathematics. Related: Evaluated; evaluating.
Show More
Online Etymology Dictionary, © 2010 Douglas Harper