Dictionary.com
definitions
  • synonyms

evaluate

[ih-val-yoo-eyt]
See more synonyms for evaluate on Thesaurus.com
verb (used with object), e·val·u·at·ed, e·val·u·at·ing.
  1. to determine or set the value or amount of; appraise: to evaluate property.
  2. to judge or determine the significance, worth, or quality of; assess: to evaluate the results of an experiment.
  3. Mathematics. to determine or calculate the numerical value of (a formula, function, relation, etc.).
Show More

Origin of evaluate

First recorded in 1835–45; back formation from evaluation
Related formse·val·u·a·ble [ih-val-yoo-uh-buhl] /ɪˈvæl yu ə bəl/, adjectivee·val·u·a·tive, adjectivee·val·u·a·tor, nounmis·e·val·u·ate, verb (used with object), mis·e·val·u·at·ed, mis·e·val·u·at·ing.non·e·val·u·a·tive, adjectivere·e·val·u·ate, verb (used with object), re·e·val·u·at·ed, re·e·val·u·at·ing.un·e·val·u·at·ed, adjective

Synonyms

See more synonyms for on Thesaurus.com
Dictionary.com Unabridged Based on the Random House Unabridged Dictionary, © Random House, Inc. 2018

Related Words

calculategradeassessgaugedecideweighcheckclassifyappraisecriticizeassayreckonvaluaterankreadratesurveyvalueestimatepeg

Examples from the Web for evaluate

Contemporary Examples

Historical Examples

  • I'll just give you my line of reasoning, and you can evaluate it for yourself.

    Vampires of Space

    Sewell Peaslee Wright

  • The historian is in a better position to evaluate the treaty.

    Union and Democracy

    Allen Johnson

  • The result is illustrative of the relation between what we do and how we evaluate what we do.

  • We cannot evaluate progress as an increase in a sum-total of happiness.

  • Our experts will evaluate such holdings and recompense the owners.

    Medal of Honor

    Dallas McCord Reynolds


British Dictionary definitions for evaluate

evaluate

verb (tr)
  1. to ascertain or set the amount or value of
  2. to judge or assess the worth of; appraise
  3. maths logic to determine the unique member of the range of a function corresponding to a given member of its domain
Show More
Derived Formsevaluation, nounevaluator, noun

Word Origin

C19: back formation from evaluation, from French, from evaluer to evaluate; see value
Collins English Dictionary - Complete & Unabridged 2012 Digital Edition © William Collins Sons & Co. Ltd. 1979, 1986 © HarperCollins Publishers 1998, 2000, 2003, 2005, 2006, 2007, 2009, 2012

Word Origin and History for evaluate

v.

1842, from French évaluer or else a back-formation from evaluation. Originally in mathematics. Related: Evaluated; evaluating.

Show More
Online Etymology Dictionary, © 2010 Douglas Harper